PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G015800.1
Common NamePOPTR_0017s04720g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 422aa    MW: 46707.4 Da    PI: 6.4007
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G015800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like888.9e-28155209156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Potri.017G015800.1 155 KMKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 209
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-27152211IPR009057Homeodomain-like
PROSITE profilePS5129418.046152211IPR017930Myb domain
SuperFamilySSF466895.02E-19153212IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26155210IPR006447Myb domain, plants
PfamPF002494.4E-8158207IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MQNTATTKDE SQEQMESYST IVSGEFPDFC DGDLLESIDF DDLFVSINEK DVLPNLEMDP  60
EILAEFSVSG SGGEESDVNT SMSNEKVEDN SIRRKDEEDK FSGSGLDSSL SSRGEEIVSK  120
KDESVVVNPV PSEDGEKGRK PTTQGKNNNN QRKRKMKVDW TPELHRRFVQ AVEQLGVDKA  180
VPSRILELMG IDCLTRHNIA SHLQKYRSHQ KHLLAREAEA ASWSQRRQMY GTAAASGGGG  240
KTDISAWHAP TMGFPPIIPM HHHFRPLHVW GHPSMDQSLM HMWPKHLAHS PYSPLPPPPT  300
WHQPDPSYWH HHAHQRGPNV LNPGTPCYPQ PPATRFHAPP VPGIPPHAMY KVDPGTGVPT  360
RHNSGPDPFL DLHPTKESVD AAIGDVLSKP WLPLPLGLKP PATDSVLVEL QKQGVPKIPP  420
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-16153207357ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150155QRKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090021e-114AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372753.10.0hypothetical protein POPTR_0017s04720g
SwissprotQ9SIV33e-98GLK1_ARATH; Transcription activator GLK1
TrEMBLU5FHY80.0U5FHY8_POPTR; Uncharacterized protein
STRINGPOPTR_0017s04720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-82GBF's pro-rich region-interacting factor 1